Glow Blend 70mg
Original price was: $150.00.$109.00Current price is: $109.00.
Lipo Fusion 10ml
$50.00
-25%
IGF-1 LR3 1mg
Original price was: $80.00.$59.99Current price is: $59.99.
“IGF-1 LR3 is for research use only.
Each batch includes a certificate of analysis provided by an independent third party laboratory based in the US.”
In stock
IGF-1 LR3 – 1 mg
Overview
FormLyophilized powder — 1 mg vial
SynonymsLong R3 IGF-1, IGF-1 LR3 Analog
UseFor laboratory research only
IGF-1 LR3 – Chemical Information
| CAS Number | 946870-92-4 |
|---|---|
| Molecular Formula | C400H625N111O115S9 |
| Molecular Weight | 9117.5 g/mol |
| Sequence | MFPAMPLLSMLGLLVLSVALGAVFNSAPLELRRLEMYCAPLKPAKSA… |
| Solubility | Soluble in sterile bacteriostatic water or 0.01 M HCl |
| Storage | Store lyophilized at 2–8 °C; protect from light. Refrigerate after reconstitution. |
Disclaimer: This compound is intended for laboratory research purposes only.
Related Products
BPC-157
Price range: $36.00 through $80.00
Select options
This product has multiple variants. The options may be chosen on the product page
GHK-Cu
Price range: $48.00 through $80.00
Select options
This product has multiple variants. The options may be chosen on the product page
Recently Viewed
AOD-9604 5mg
$60.00
BPC-157
Price range: $36.00 through $80.00
GLP-C 10mg
Original price was: $120.00.$80.00Current price is: $80.00.
CJC-1295 (No DAC) 5mg
$80.00
CJC-1295 DAC 10mg
$110.00
DSIP 5mg
Original price was: $38.00.$26.00Current price is: $26.00.